PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.C01967.1.p
Common NameEUGRSUZ_C01967
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family FAR1
Protein Properties Length: 637aa    MW: 73115.4 Da    PI: 8.8039
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.C01967.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR156.31e-171297290
              FAR1  2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
                       Yn+YA   GF vrk ++ ++  +g     tf C++eg++ +   + e++   r+++r gCka++k k e +g+w+v k+e  HnH+++
  Eucgr.C01967.1.p 12 TYNAYAICKGFGVRKGQKANN-SKGILRACTFLCNCEGYSPPILPH-EQRDIYRTVKRSGCKACIKFKIE-EGVWVVVKFEDVHNHPFV 97
                      6***************98887.7777999************99888.99999*****************9.***************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.0E-141297IPR004330FAR1 DNA binding domain
PfamPF105516.8E-33219313IPR018289MULE transposase domain
PROSITE profilePS509669.446454501IPR007527Zinc finger, SWIM-type
PfamPF044342.3E-4472494IPR007527Zinc finger, SWIM-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 637 aa     Download sequence    Send to blast
MKFANEDEAY NTYNAYAICK GFGVRKGQKA NNSKGILRAC TFLCNCEGYS PPILPHEQRD  60
IYRTVKRSGC KACIKFKIEE GVWVVVKFED VHNHPFVDDK QKHLIRSYRH ITNTNGSILT  120
SLVGAGVRAT KAYSYLSGEA GGQEIVGFTL RDCHNFLQSK RRAFITAGDC QSLINHFNCL  180
QLNGSNFSYT FQLDQEQRLT NFFWSDGISK LDYESFGDVV VFDATYRTNK YNMICAPFVG  240
LNHHWKNVLF DCAFLLDETI ASFVWALQSF LEAMGNKAPK TIFTDQDHAM ANAIRTVLPN  300
TSHRLCVWHI GKNATHHIGH LLGKPGFRDK YWHKILYKCE SEFEMENTWK AMCHEWKLED  360
NKWLDNIYRL RHKWCPAFGR DTFSAGIRST QRSESTNNVF QDMACKTMTL SEFVNHYEKQ  420
AEKMRNSEVI DDFECARGMP RIMVEKIDGP LHTYILGAEN SERKHIVHFC SGDSTITCSC  480
KLFEMRGWLC RHTLCILTHV VNVTSIPSRY ILKRWTKTAK QSSHCNDSKT LRLKRLMQLA  540
FSVMNISANH DVTENIATTT LMDLHSRIVN KMQYLTGKDD VNSLLENDES EYAANCGIQI  600
HDPLRRRPKG IPNTRLKSTN EKRKRKESSY TGGTSK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1604625RRRPKGIPNTRLKSTNEKRKRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.C01967.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010028196.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_010028197.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_010028199.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_010028200.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_010028201.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_010028202.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_010028203.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2
TrEMBLA0A059CQZ30.0A0A059CQZ3_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM11826253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-100FAR1-related sequence 5